DHRS1_HUMAN Q96LJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96LJ7
Recommended name：Dehydrogenase/reductase SDR family member 1
EC number：
Alternative names：(Short chain dehydrogenase/reductase family 19C member 1)
Cleaved into：
GeneID：115817
Gene names (primary )：DHRS1
Gene names (synonym )：SDR19C1
Gene names (ORF )：
Length：313
Mass：33909
Sequence：MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
Tissue specificity：Detected in heart and liver, and at low levels in skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12153138}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family