CNEP1_HUMAN   O95476


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95476

Recommended name:CTD nuclear envelope phosphatase 1

EC number:EC:3.1.3.16

Alternative names:(Serine/threonine-protein phosphatase dullard)

Cleaved into:

GeneID:23399

Gene names  (primary ):CTDNEP1

Gene names  (synonym ):DULLARD

Gene names  (ORF ):

Length:244

Mass:28377

Sequence:MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Tissue specificity:Muscle specific with lower expression in other metabolic tissues. {ECO:0000269|PubMed:22134922}.

Induction:

Developmental stage:

Protein families:Dullard family


   💬 WhatsApp