TRY6_HUMAN   Q8NHM4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NHM4

Recommended name:Putative trypsin-6

EC number:EC:3.4.21.4

Alternative names:(Serine protease 3 pseudogene 2) (Trypsinogen C)

Cleaved into:

GeneID:

Gene names  (primary ):PRSS3P2

Gene names  (synonym ):T6 TRY6

Gene names  (ORF ):

Length:247

Mass:26537

Sequence:MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNRIILNNDIMLIKLSTPAVINAHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIKDTIAANS

Tissue specificity:Overexpressed in metastasing in non small cell lung tumors, leading to an enhanced cell migration. {ECO:0000269|PubMed:15313892}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Tryptase subfamily


   💬 WhatsApp