ORN_HUMAN   Q9Y3B8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y3B8

Recommended name:Oligoribonuclease, mitochondrial

EC number:EC:3.1.-.-

Alternative names:(RNA exonuclease 2 homolog) (Small fragment nuclease)

Cleaved into:

GeneID:25996

Gene names  (primary ):REXO2

Gene names  (synonym ):SFN SMFN

Gene names  (ORF ):CGI-114

Length:237

Mass:26833

Sequence:MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Oligoribonuclease family


   💬 WhatsApp