RN182_HUMAN   Q8N6D2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N6D2

Recommended name:E3 ubiquitin-protein ligase RNF182

EC number:EC:2.3.2.27

Alternative names:(RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)

Cleaved into:

GeneID:221687

Gene names  (primary ):RNF182

Gene names  (synonym ):

Gene names  (ORF ):

Length:247

Mass:27402

Sequence:MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS

Tissue specificity:Up-regulated in neuronal cells subjected to cell death-inducing injuries, such as oxygen and glucose deprivation (at protein level). Could be up-regulated in Alzheimer disease brains (PubMed:18298843). Highly expressed in innate immune organs such as lymph nodes and spleen and in immune cells such as macrophages and dendritic cells (PubMed:31432514). {ECO:0000269|PubMed:18298843, ECO:0000269|PubMed:31432514}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp