RNT2_HUMAN   O00584


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O00584

Recommended name:Ribonuclease T2

EC number:EC:4.6.1.19

Alternative names:(Ribonuclease 6)

Cleaved into:

GeneID:8635

Gene names  (primary ):RNASET2

Gene names  (synonym ):RNASE6PL

Gene names  (ORF ):

Length:256

Mass:29481

Sequence:MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

Tissue specificity:Ubiquitous. Higher expression levels observed in the temporal lobe and fetal brain. {ECO:0000269|PubMed:19525954}.

Induction:

Developmental stage:

Protein families:RNase T2 family


   💬 WhatsApp