RSLAB_HUMAN   Q96S79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96S79

Recommended name:Ras-like protein family member 10B

EC number:EC:3.6.5.2

Alternative names:(Ras-like protein VTS58635) (Ras-related protein 17) (RRP17)

Cleaved into:

GeneID:91608

Gene names  (primary ):RASL10B

Gene names  (synonym ):

Gene names  (ORF ):

Length:203

Mass:23229

Sequence:MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM

Tissue specificity:Expressed at high levels in skeletal muscle and, at much lower levels, in heart, brain and pancreas. {ECO:0000269|PubMed:17984325}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Ras family


   💬 WhatsApp