IPYR_HUMAN   Q15181


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15181

Recommended name:Inorganic pyrophosphatase

EC number:EC:3.6.1.1

Alternative names:(Pyrophosphate phospho-hydrolase) (PPase)

Cleaved into:

GeneID:5464

Gene names  (primary ):PPA1

Gene names  (synonym ):IOPPP PP

Gene names  (ORF ):

Length:289

Mass:32660

Sequence:MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Tissue specificity:Expressed ubiquitously. {ECO:0000269|PubMed:10542310}.

Induction:

Developmental stage:

Protein families:PPase family


   💬 WhatsApp