PTPM1_HUMAN   Q8WUK0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WUK0

Recommended name:Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1

EC number:EC:3.1.3.27

Alternative names:(PTEN-like phosphatase) (Phosphoinositide lipid phosphatase) (Protein-tyrosine phosphatase mitochondrial 1)

Cleaved into:

GeneID:114971

Gene names  (primary ):PTPMT1

Gene names  (synonym ):MOSP PLIP

Gene names  (ORF ):PNAS-129

Length:201

Mass:22844

Sequence:MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily


   💬 WhatsApp