PTN1_HUMAN   P18031


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18031

Recommended name:Tyrosine-protein phosphatase non-receptor type 1

EC number:EC:3.1.3.48

Alternative names:(Protein-tyrosine phosphatase 1B) (PTP-1B)

Cleaved into:

GeneID:5770

Gene names  (primary ):PTPN1

Gene names  (synonym ):PTP1B

Gene names  (ORF ):

Length:435

Mass:49967

Sequence:MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

Tissue specificity:Expressed in keratinocytes (at protein level). {ECO:0000269|PubMed:29043977}.

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class 1 subfamily


   💬 WhatsApp