CDKL1_HUMAN   Q00532


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00532

Recommended name:Cyclin-dependent kinase-like 1

EC number:EC:2.7.11.22

Alternative names:(Protein kinase p42 KKIALRE) (Serine/threonine-protein kinase KKIALRE)

Cleaved into:

GeneID:8814

Gene names  (primary ):CDKL1

Gene names  (synonym ):

Gene names  (ORF ):

Length:358

Mass:41803

Sequence:MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

Tissue specificity:Highly expressed in kidney, and to a lower extent in ovary. {ECO:0000269|PubMed:9000130}.

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily


   💬 WhatsApp