PLPL4_HUMAN   P41247


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P41247

Recommended name:Patatin-like phospholipase domain-containing protein 4

EC number:EC:3.1.1.3

Alternative names:(Protein GS2)

Cleaved into:

GeneID:8228

Gene names  (primary ):PNPLA4

Gene names  (synonym ):DXS1283E GS2

Gene names  (ORF ):

Length:253

Mass:27980

Sequence:MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE

Tissue specificity:Expressed in all tissues examined, including heart, brain, placenta, lung, liver, muscle, kidney, pancreas and spleen. {ECO:0000269|PubMed:7806223}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp