RNF5_HUMAN   Q99942


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99942

Recommended name:E3 ubiquitin-protein ligase RNF5

EC number:EC:2.3.2.27

Alternative names:(Protein G16) (RING finger protein 5) (RING-type E3 ubiquitin transferase RNF5) (Ram1 homolog) (HsRma1)

Cleaved into:

GeneID:6048

Gene names  (primary ):RNF5

Gene names  (synonym ):G16 NG2 RMA1

Gene names  (ORF ):

Length:180

Mass:19881

Sequence:MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:9533025}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp