PDES1_HUMAN   A5PLL7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A5PLL7

Recommended name:Plasmanylethanolamine desaturase

EC number:EC:1.14.19.77

Alternative names:(Plasmanylethanolamine desaturase 1) (Transmembrane protein 189)

Cleaved into:

GeneID:387521

Gene names  (primary ):PEDS1

Gene names  (synonym ):KUA PDES TMEM189

Gene names  (ORF ):

Length:270

Mass:31135

Sequence:MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Fatty acid desaturase CarF family


   💬 WhatsApp