RDH8_HUMAN Q9NYR8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NYR8
Recommended name：Retinol dehydrogenase 8
EC number：EC:1.1.1.300
Alternative names：(Photoreceptor outer segment all-trans retinol dehydrogenase) (Short chain dehydrogenase/reductase family 28C member 2)
Cleaved into：
GeneID：50700
Gene names (primary )：RDH8
Gene names (synonym )：PRRDH SDR28C2
Gene names (ORF )：
Length：311
Mass：33755
Sequence：MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR
Tissue specificity：Detected in photoreceptor outer segments in the retina (at protein level). {ECO:0000269|PubMed:10753906}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family