CDIPT_HUMAN O14735
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14735
Recommended name：CDP-diacylglycerol--inositol 3-phosphatidyltransferase
EC number：EC:2.7.8.11
Alternative names：(Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase)
Cleaved into：
GeneID：10423
Gene names (primary )：CDIPT
Gene names (synonym )：PIS PIS1
Gene names (ORF )：
Length：213
Mass：23539
Sequence：MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
Tissue specificity：Detected in placenta (at protein level). Widely expressed. Higher expression in adult liver and skeletal muscle, slightly lower levels seen in pancreas, kidney, lung, placenta, brain, heart, leukocyte, colon, small intestine, ovary, testis, prostate, thymus and spleen. In fetus, expressed in kidney, liver, lung and brain. {ECO:0000269|PubMed:8110188}.
Induction：
Developmental stage：
Protein families：CDP-alcohol phosphatidyltransferase class-I family