ODPAT_HUMAN   P29803


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P29803

Recommended name:Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

EC number:EC:1.2.4.1

Alternative names:(PDHE1-A type II)

Cleaved into:

GeneID:5161

Gene names  (primary ):PDHA2

Gene names  (synonym ):PDHAL

Gene names  (ORF ):

Length:388

Mass:42933

Sequence:MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

Tissue specificity:Testis. Expressed in postmeiotic spermatogenic cells. {ECO:0000269|PubMed:22750801}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp