DR9C7_HUMAN Q8NEX9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NEX9
Recommended name：Short-chain dehydrogenase/reductase family 9C member 7
EC number：EC:1.1.1.-
Alternative names：(Orphan short-chain dehydrogenase/reductase) (SDR-O) (RDH-S)
Cleaved into：
GeneID：121214
Gene names (primary )：SDR9C7
Gene names (synonym )：RDHS SDRO
Gene names (ORF )：
Length：313
Mass：35263
Sequence：MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV
Tissue specificity：Expressed in the skin (PubMed:28173123). Expressed in granular and cornified layers of the epidermis (at protein level) (PubMed:28173123). Highly expressed in liver (PubMed:12234675). {ECO:0000269|PubMed:12234675}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family