NUDT7_HUMAN   P0C024


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C024

Recommended name:Peroxisomal coenzyme A diphosphatase NUDT7

EC number:EC:3.6.1.-

Alternative names:(Nucleoside diphosphate-linked moiety X motif 7) (Nudix motif 7)

Cleaved into:

GeneID:283927

Gene names  (primary ):NUDT7

Gene names  (synonym ):

Gene names  (ORF ):

Length:238

Mass:26942

Sequence:MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL

Tissue specificity:Expressed in liver, kidney, pancreas, pituitary, small intestine, spleen, heart and placenta. Weakly expressed in brain. {ECO:0000269|PubMed:11415433}.

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, PCD1 subfamily


   💬 WhatsApp