NAA10_HUMAN P41227
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41227
Recommended name:N-alpha-acetyltransferase 10
EC number:EC:2.3.1.255
Alternative names:(N-terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10)
Cleaved into:
GeneID:8260
Gene names (primary ):NAA10
Gene names (synonym ):ARD1 ARD1A TE2
Gene names (ORF ):
Length:235
Mass:26459
Sequence:MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:12464182}.
Induction:
Developmental stage:
Protein families:Acetyltransferase family, ARD1 subfamily