NSN5C_HUMAN   Q63ZY6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63ZY6

Recommended name:Putative methyltransferase NSUN5C

EC number:EC:2.1.1.-

Alternative names:(NOL1/NOP2/Sun domain family member 5C) (Williams-Beuren syndrome chromosomal region 20C protein)

Cleaved into:

GeneID:

Gene names  (primary ):NSUN5P2

Gene names  (synonym ):NSUN5C WBSCR20B WBSCR20C

Gene names  (ORF ):

Length:315

Mass:34347

Sequence:MPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHLAALLKNQGKIFAFDLDARRLASMATLLAWAGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVQDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAKSCSRCLHTALHIAEAPGSLLPGGKGRCLSSPWKTLGPHRRQQFAF

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:11978965, ECO:0000269|PubMed:12073013}.

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, RsmB/NOP family


   💬 WhatsApp