NEK7_HUMAN Q8TDX7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TDX7
Recommended name:Serine/threonine-protein kinase Nek7
EC number:EC:2.7.11.1
Alternative names:(Never in mitosis A-related kinase 7) (NimA-related protein kinase 7)
Cleaved into:
GeneID:140609
Gene names (primary ):NEK7
Gene names (synonym ):
Gene names (ORF ):
Length:302
Mass:34551
Sequence:MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS
Tissue specificity:Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine. {ECO:0000269|PubMed:11701951}.
Induction:
Developmental stage:
Protein families:Protein kinase superfamily, NEK Ser/Thr protein kinase family, NIMA subfamily