NU4LM_HUMAN   P03901


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P03901

Recommended name:NADH-ubiquinone oxidoreductase chain 4L

EC number:EC:7.1.1.2

Alternative names:(NADH dehydrogenase subunit 4L)

Cleaved into:

GeneID:4539

Gene names  (primary ):MT-ND4L

Gene names  (synonym ):MTND4L NADH4L ND4L

Gene names  (ORF ):

Length:98

Mass:10741

Sequence:MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I subunit 4L family


   💬 WhatsApp