OSGP2_HUMAN Q9H4B0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H4B0
Recommended name：Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
EC number：EC:2.3.1.234
Alternative names：(N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (O-sialoglycoprotein endopeptidase-like protein 1) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1) (tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1)
Cleaved into：
GeneID：64172
Gene names (primary )：OSGEPL1
Gene names (synonym )：GCP1
Gene names (ORF )：
Length：414
Mass：45123
Sequence：MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI
Tissue specificity：Widely expressed, with maximum expression in pituitary gland, prostate, rectum and uterus. {ECO:0000269|PubMed:19694617}.
Induction：
Developmental stage：
Protein families：KAE1 / TsaD family