MT21D_HUMAN   Q9H867


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H867

Recommended name:Protein-lysine methyltransferase METTL21D

EC number:EC:2.1.1.-

Alternative names:(Methyltransferase-like protein 21D) (VCP lysine methyltransferase) (VCP-KMT) (Valosin-containing protein lysine methyltransferase)

Cleaved into:

GeneID:79609

Gene names  (primary ):VCPKMT

Gene names  (synonym ):C14orf138 METTL21D

Gene names  (ORF ):

Length:229

Mass:25807

Sequence:MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Methyltransferase superfamily, METTL21 family


   💬 WhatsApp