EFMT2_HUMAN   Q5JPI9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5JPI9

Recommended name:EEF1A lysine methyltransferase 2

EC number:EC:2.1.1.-

Alternative names:(Methyltransferase-like protein 10) (Protein-lysine N-methyltransferase METTL10)

Cleaved into:

GeneID:399818

Gene names  (primary ):EEF1AKMT2

Gene names  (synonym ):C10orf138 METTL10

Gene names  (ORF ):

Length:291

Mass:31830

Sequence:MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFLITSCNWTKEELLNEFSEGWSTVAGFWLTAALTSWAQAIFSTSASRVGGTTGTHHHAWIIFVFLAETRFCHVVQAGLELLGSSDSPTWPPKVLGLYHARPSLAF

Tissue specificity:

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, EFM4 family


   💬 WhatsApp