PSB7_HUMAN   Q99436


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99436

Recommended name:Proteasome subunit beta type-7

EC number:EC:3.4.25.1

Alternative names:(Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z)

Cleaved into:

GeneID:5695

Gene names  (primary ):PSMB7

Gene names  (synonym ):Z

Gene names  (ORF ):

Length:277

Mass:29965

Sequence:MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Tissue specificity:Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues. {ECO:0000269|PubMed:18549262}.

Induction:

Developmental stage:

Protein families:Peptidase T1B family


   💬 WhatsApp