STK11_HUMAN   Q15831


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15831

Recommended name:Serine/threonine-protein kinase STK11

EC number:EC:2.7.11.1

Alternative names:(Liver kinase B1) (LKB1) (hLKB1) (Renal carcinoma antigen NY-REN-19)

Cleaved into:

GeneID:6794

Gene names  (primary ):STK11

Gene names  (synonym ):LKB1 PJS

Gene names  (ORF ):

Length:433

Mass:48636

Sequence:MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ

Tissue specificity:Ubiquitously expressed. Strongest expression in testis and fetal liver.

Induction:

Developmental stage:

Protein families:Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily


   💬 WhatsApp