PLPR5_HUMAN Q32ZL2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q32ZL2
Recommended name：Phospholipid phosphatase-related protein type 5
EC number：EC:3.1.3.-
Alternative names：(Lipid phosphate phosphatase-related protein type 5) (Phosphatidic acid phosphatase type 2d) (Plasticity-related gene 5 protein) (PRG-5)
Cleaved into：
GeneID：163404
Gene names (primary )：PLPPR5
Gene names (synonym )：LPPR5 PAP2D PRG5
Gene names (ORF )：
Length：321
Mass：35427
Sequence：MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT
Tissue specificity：Isoform 1 is expressed in brain, lung, kidney and colon. Isoform 2 is expressed in placenta, skeletal muscle and kidney. {ECO:0000269|PubMed:16010976}.
Induction：
Developmental stage：
Protein families：PA-phosphatase related phosphoesterase family