LDAH_HUMAN   Q9H6V9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H6V9

Recommended name:Lipid droplet-associated hydrolase

EC number:EC:3.1.1.-

Alternative names:(Lipid droplet-associated serine hydrolase) (hLDAH)

Cleaved into:

GeneID:60526

Gene names  (primary ):LDAH

Gene names  (synonym ):C2orf43

Gene names  (ORF ):

Length:325

Mass:37319

Sequence:MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM

Tissue specificity:Present in macrophage-rich areas in atherosclerotic lesionsv(at protein level). {ECO:0000269|PubMed:24357060}.

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, LDAH family


   💬 WhatsApp