KLK12_HUMAN   Q9UKR0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UKR0

Recommended name:Kallikrein-12

EC number:EC:3.4.21.-

Alternative names:(Kallikrein-like protein 5) (KLK-L5)

Cleaved into:

GeneID:43849

Gene names  (primary ):KLK12

Gene names  (synonym ):KLKL5

Gene names  (ORF ):UNQ669/PRO1303

Length:248

Mass:26734

Sequence:MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Kallikrein subfamily


   💬 WhatsApp