JOS1_HUMAN   Q15040


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15040

Recommended name:Josephin-1

EC number:EC:3.4.19.12

Alternative names:(Josephin domain-containing protein 1)

Cleaved into:

GeneID:9929

Gene names  (primary ):JOSD1

Gene names  (synonym ):JSPH1 KIAA0063

Gene names  (ORF ):

Length:202

Mass:23198

Sequence:MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp