R144B_HUMAN Q7Z419
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z419
Recommended name：E3 ubiquitin-protein ligase RNF144B
EC number：EC:2.3.2.31
Alternative names：(IBR domain-containing protein 2) (RING finger protein 144B) (p53-inducible RING finger protein)
Cleaved into：
GeneID：255488
Gene names (primary )：RNF144B
Gene names (synonym )：IBRDC2 P53RFP
Gene names (ORF )：
Length：303
Mass：33697
Sequence：MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT
Tissue specificity：Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis. {ECO:0000269|PubMed:16427630, ECO:0000269|PubMed:20300062}.
Induction：
Developmental stage：
Protein families：RBR family, RNF144 subfamily