TP4A2_HUMAN Q12974
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q12974
Recommended name：Protein tyrosine phosphatase type IVA 2
EC number：EC:3.1.3.48
Alternative names：(HU-PP-1) (OV-1) (PTP(CAAXII)) (Protein-tyrosine phosphatase 4a2) (Protein-tyrosine phosphatase of regenerating liver 2) (PRL-2)
Cleaved into：
GeneID：8073
Gene names (primary )：PTP4A2
Gene names (synonym )：PRL2 PTPCAAX2
Gene names (ORF )：BM-008
Length：167
Mass：19127
Sequence：MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Tissue specificity：Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue. {ECO:0000269|PubMed:10940933, ECO:0000269|PubMed:11734337, ECO:0000269|PubMed:8661118}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family