EFMT3_HUMAN   Q96AZ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96AZ1

Recommended name:EEF1A lysine methyltransferase 3

EC number:EC:2.1.1.-

Alternative names:(Hepatocellular carcinoma-associated antigen 557a) (Methyltransferase-like protein 21B) (Protein-lysine methyltransferase METTL21B)

Cleaved into:

GeneID:25895

Gene names  (primary ):EEF1AKMT3

Gene names  (synonym ):FAM119B HCA557A METTL21B

Gene names  (ORF ):

Length:226

Mass:24911

Sequence:MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Methyltransferase superfamily, METTL21 family


   💬 WhatsApp