TATD1_HUMAN   Q6P1N9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6P1N9

Recommended name:Putative deoxyribonuclease TATDN1

EC number:EC:3.1.21.-

Alternative names:(Hepatocarcinoma high expression protein)

Cleaved into:

GeneID:83940

Gene names  (primary ):TATDN1

Gene names  (synonym ):

Gene names  (ORF ):CDA11

Length:297

Mass:33602

Sequence:MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMFFSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLELANTLYNNTIKVFFPGI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Metallo-dependent hydrolases superfamily, TatD-type hydrolase family


   💬 WhatsApp