HDDC2_HUMAN   Q7Z4H3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z4H3

Recommended name:5'-deoxynucleotidase HDDC2

EC number:EC:3.1.3.89

Alternative names:(HD domain-containing protein 2) (Hepatitis C virus NS5A-transactivated protein 2) (HCV NS5A-transactivated protein 2)

Cleaved into:

GeneID:51020

Gene names  (primary ):HDDC2

Gene names  (synonym ):C6orf74 NS5ATP2

Gene names  (ORF ):CGI-130

Length:204

Mass:23390

Sequence:MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS

Tissue specificity:

Induction:

Developmental stage:

Protein families:HDDC2 family


   💬 WhatsApp