RAP1B_HUMAN   P61224


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61224

Recommended name:Ras-related protein Rap-1b

EC number:EC:3.6.5.2

Alternative names:(GTP-binding protein smg p21B)

Cleaved into:

GeneID:5908

Gene names  (primary ):RAP1B

Gene names  (synonym ):

Gene names  (ORF ):OK/SW-cl.11

Length:184

Mass:20825

Sequence:MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Ras family


   💬 WhatsApp