GSTA2_HUMAN   P09210


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09210

Recommended name:Glutathione S-transferase A2

EC number:EC:2.5.1.18

Alternative names:(GST HA subunit 2) (GST class-alpha member 2) (GST-gamma) (GSTA2-2) (GTH2)

Cleaved into:

GeneID:2939

Gene names  (primary ):GSTA2

Gene names  (synonym ):GST2

Gene names  (ORF ):

Length:222

Mass:25664

Sequence:MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Tissue specificity:Liver.

Induction:

Developmental stage:

Protein families:GST superfamily, Alpha family


   💬 WhatsApp