PA2GX_HUMAN O15496
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15496
Recommended name：Group 10 secretory phospholipase A2
EC number：EC:3.1.1.4
Alternative names：(Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)
Cleaved into：
GeneID：8399
Gene names (primary )：PLA2G10
Gene names (synonym )：
Gene names (ORF )：
Length：165
Mass：18153
Sequence：MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Tissue specificity：Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon (PubMed:9188469). Expressed in neuronal fibers in dorsal root ganglia and in peripheral tissues including stomach, white adipose tissue and prostate (at protein level) (PubMed:21266581). {ECO:0000269|PubMed:21266581, ECO:0000269|PubMed:9188469}.
Induction：
Developmental stage：
Protein families：Phospholipase A2 family