GL6D1_HUMAN   Q7Z4J2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z4J2

Recommended name:Putative glycosyltransferase 6 domain-containing protein 1

EC number:EC:2.4.1.-

Alternative names:(Galactosyltransferase family 6 domain-containing 1)

Cleaved into:

GeneID:360203

Gene names  (primary ):GLT6D1

Gene names  (synonym ):GLTDC1 GT6M7

Gene names  (ORF ):

Length:276

Mass:32608

Sequence:MNSKRMLLLVLFAFSLMLVERYFRNHQVEELRLSDWFHPRKRPDVITKTDWLAPVLWEGTFDRRVLEKHYRRRNITVGLAVFATGRFAEEYLRPFLHSANKHFMTGYRVIFYIMVDAFFKLPDIEPSPLRTFKAFKVGTERWWLDGPLVHVKSLGEHIASHIQDEVDFLFSMAANQVFQNEFGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYEKHLNKYFYLNKPT

Tissue specificity:Expressed in both healthy and inflamed gingival tissue samples at similar levels, with higher expression in the gingival connective tissue compared to gingival epithelium. Strongest expression in testis, followed by leukocytes. {ECO:0000269|PubMed:19897590}.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 6 family


   💬 WhatsApp