IF2G_HUMAN P41091
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41091
Recommended name：Eukaryotic translation initiation factor 2 subunit 3
EC number：EC:3.6.5.3
Alternative names：(Eukaryotic translation initiation factor 2 subunit gamma X) (eIF-2-gamma X) (eIF-2gX)
Cleaved into：
GeneID：1968
Gene names (primary )：EIF2S3
Gene names (synonym )：EIF2G
Gene names (ORF )：
Length：472
Mass：51109
Sequence：MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Tissue specificity：Expressed in testis, brain, liver and muscle. {ECO:0000269|PubMed:9736774}.
Induction：
Developmental stage：
Protein families：TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EIF2G subfamily