CELA1_HUMAN Q9UNI1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UNI1
Recommended name：Chymotrypsin-like elastase family member 1
EC number：EC:3.4.21.36
Alternative names：(Elastase-1) (Pancreatic elastase 1)
Cleaved into：
GeneID：1990
Gene names (primary )：CELA1
Gene names (synonym )：ELA1
Gene names (ORF )：
Length：258
Mass：27798
Sequence：MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
Tissue specificity：Basal layers of epidermis (at protein level). Not expressed in the pancreas. {ECO:0000269|PubMed:10620133}.
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Elastase subfamily