CEL3B_HUMAN   P08861


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08861

Recommended name:Chymotrypsin-like elastase family member 3B

EC number:EC:3.4.21.70

Alternative names:(Elastase IIIB) (Elastase-3B) (Protease E)

Cleaved into:

GeneID:23436

Gene names  (primary ):CELA3B

Gene names  (synonym ):ELA3B

Gene names  (ORF ):

Length:270

Mass:29263

Sequence:MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH

Tissue specificity:Pancreas. Not detectable in keratinocytes. {ECO:0000269|PubMed:10620133}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Elastase subfamily


   💬 WhatsApp