CEL3A_HUMAN   P09093


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09093

Recommended name:Chymotrypsin-like elastase family member 3A

EC number:EC:3.4.21.70

Alternative names:(Elastase IIIA) (Elastase-3A) (Protease E)

Cleaved into:

GeneID:10136

Gene names  (primary ):CELA3A

Gene names  (synonym ):ELA3 ELA3A

Gene names  (ORF ):

Length:270

Mass:29489

Sequence:MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Elastase subfamily


   💬 WhatsApp