UBE2Z_HUMAN Q9H832
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H832
Recommended name：Ubiquitin-conjugating enzyme E2 Z
EC number：EC:2.3.2.23
Alternative names：(E2 ubiquitin-conjugating enzyme Z) (Uba6-specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin-protein ligase Z)
Cleaved into：
GeneID：65264
Gene names (primary )：UBE2Z
Gene names (synonym )：
Gene names (ORF )：HOYS7
Length：354
Mass：38210
Sequence：MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Tissue specificity：Widely expressed. Highly in placenta, pancreas, spleen and testis. {ECO:0000269|PubMed:17160626, ECO:0000269|PubMed:17597759}.
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family