UB2G2_HUMAN P60604
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60604
Recommended name：Ubiquitin-conjugating enzyme E2 G2
EC number：EC:2.3.2.23
Alternative names：(E2 ubiquitin-conjugating enzyme G2) (Ubiquitin carrier protein G2) (Ubiquitin-protein ligase G2)
Cleaved into：
GeneID：7327
Gene names (primary )：UBE2G2
Gene names (synonym )：UBC7
Gene names (ORF )：
Length：165
Mass：18566
Sequence：MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family