UB2E3_HUMAN Q969T4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969T4
Recommended name：Ubiquitin-conjugating enzyme E2 E3
EC number：EC:2.3.2.23
Alternative names：(E2 ubiquitin-conjugating enzyme E3) (UbcH9) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (Ubiquitin-protein ligase E3)
Cleaved into：
GeneID：10477
Gene names (primary )：UBE2E3
Gene names (synonym )：UBCE4 UBCH9
Gene names (ORF )：
Length：207
Mass：22913
Sequence：MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
Tissue specificity：Ubiquitously expressed at low levels. Highly expressed in skeletal muscle. {ECO:0000269|PubMed:10343118}.
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family