UB2E2_HUMAN   Q96LR5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96LR5

Recommended name:Ubiquitin-conjugating enzyme E2 E2

EC number:EC:2.3.2.23

Alternative names:(E2 ubiquitin-conjugating enzyme E2) (UbcH8) (Ubiquitin carrier protein E2) (Ubiquitin-protein ligase E2)

Cleaved into:

GeneID:7325

Gene names  (primary ):UBE2E2

Gene names  (synonym ):UBCH8

Gene names  (ORF ):

Length:201

Mass:22255

Sequence:MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family


   💬 WhatsApp