PIGP_HUMAN P57054
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P57054
Recommended name：Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
EC number：EC:2.4.1.198
Alternative names：(Down syndrome critical region protein 5) (Down syndrome critical region protein C) (Phosphatidylinositol-glycan biosynthesis class P protein) (PIG-P)
Cleaved into：
GeneID：51227
Gene names (primary )：PIGP
Gene names (synonym )：DCRC DSCR5 DSCRC
Gene names (ORF )：NPD010
Length：158
Mass：18089
Sequence：MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
Tissue specificity：Ubiquitous.
Induction：
Developmental stage：
Protein families：PIGP family